Anti TRIM56 pAb (ATL-HPA024358)

Atlas Antibodies

Catalog No.:
ATL-HPA024358-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 56
Gene Name: TRIM56
Alternative Gene Name: RNF109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043279: 88%, ENSRNOG00000018356: 29%
Entrez Gene ID: 81844
Uniprot ID: Q9BRZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PECRETVPVPPEGVASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRC
Gene Sequence PECRETVPVPPEGVASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRC
Gene ID - Mouse ENSMUSG00000043279
Gene ID - Rat ENSRNOG00000018356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM56 pAb (ATL-HPA024358)
Datasheet Anti TRIM56 pAb (ATL-HPA024358) Datasheet (External Link)
Vendor Page Anti TRIM56 pAb (ATL-HPA024358) at Atlas Antibodies

Documents & Links for Anti TRIM56 pAb (ATL-HPA024358)
Datasheet Anti TRIM56 pAb (ATL-HPA024358) Datasheet (External Link)
Vendor Page Anti TRIM56 pAb (ATL-HPA024358)
Citations for Anti TRIM56 pAb (ATL-HPA024358) – 1 Found
Xue, Min; Zhang, Kai; Mu, Kun; Xu, Juntao; Yang, Huijie; Liu, Yun; Wang, Beibei; Wang, Zhonghao; Li, Zhongbo; Kong, Qiong; Li, Xiumin; Wang, Hui; Zhu, Jian; Zhuang, Ting. Regulation of estrogen signaling and breast cancer proliferation by an ubiquitin ligase TRIM56. Oncogenesis. 2019;8(5):30.  PubMed