Anti TRIM55 pAb (ATL-HPA053691)

Atlas Antibodies

Catalog No.:
ATL-HPA053691-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 55
Gene Name: TRIM55
Alternative Gene Name: MURF-2, RNF29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060913: 91%, ENSRNOG00000012723: 90%
Entrez Gene ID: 84675
Uniprot ID: Q9BYV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
Gene Sequence SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
Gene ID - Mouse ENSMUSG00000060913
Gene ID - Rat ENSRNOG00000012723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM55 pAb (ATL-HPA053691)
Datasheet Anti TRIM55 pAb (ATL-HPA053691) Datasheet (External Link)
Vendor Page Anti TRIM55 pAb (ATL-HPA053691) at Atlas Antibodies

Documents & Links for Anti TRIM55 pAb (ATL-HPA053691)
Datasheet Anti TRIM55 pAb (ATL-HPA053691) Datasheet (External Link)
Vendor Page Anti TRIM55 pAb (ATL-HPA053691)