Anti TRIM41 pAb (ATL-HPA024204)

Atlas Antibodies

Catalog No.: ATL-HPA024204-25

Protein Description: tripartite motif containing 41
Gene Name: TRIM41
Alternative Gene Name: MGC1127, RINCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040365: 94%, ENSRNOG00000002388: 94%
Entrez Gene ID: 90933
Uniprot ID: Q8WV44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA
• Gene Sequence: RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA
• Gene ID - Mouse: ENSMUSG00000040365
• Gene ID - Rat: ENSRNOG00000002388
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.