Anti TRIM26 pAb (ATL-HPA050456)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050456-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TRIM26
Alternative Gene Name: RNF95, ZNF173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024457: 91%, ENSRNOG00000032930: 89%
Entrez Gene ID: 7726
Uniprot ID: Q12899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVM |
Gene Sequence | FKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVM |
Gene ID - Mouse | ENSMUSG00000024457 |
Gene ID - Rat | ENSRNOG00000032930 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRIM26 pAb (ATL-HPA050456) | |
Datasheet | Anti TRIM26 pAb (ATL-HPA050456) Datasheet (External Link) |
Vendor Page | Anti TRIM26 pAb (ATL-HPA050456) at Atlas Antibodies |
Documents & Links for Anti TRIM26 pAb (ATL-HPA050456) | |
Datasheet | Anti TRIM26 pAb (ATL-HPA050456) Datasheet (External Link) |
Vendor Page | Anti TRIM26 pAb (ATL-HPA050456) |