Anti TRIM26 pAb (ATL-HPA044975)

Atlas Antibodies

Catalog No.:
ATL-HPA044975-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 26
Gene Name: TRIM26
Alternative Gene Name: RNF95, ZNF173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024457: 88%, ENSRNOG00000032930: 88%
Entrez Gene ID: 7726
Uniprot ID: Q12899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGRE
Gene Sequence ESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGRE
Gene ID - Mouse ENSMUSG00000024457
Gene ID - Rat ENSRNOG00000032930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM26 pAb (ATL-HPA044975)
Datasheet Anti TRIM26 pAb (ATL-HPA044975) Datasheet (External Link)
Vendor Page Anti TRIM26 pAb (ATL-HPA044975) at Atlas Antibodies

Documents & Links for Anti TRIM26 pAb (ATL-HPA044975)
Datasheet Anti TRIM26 pAb (ATL-HPA044975) Datasheet (External Link)
Vendor Page Anti TRIM26 pAb (ATL-HPA044975)