Anti TREX1 pAb (ATL-HPA035437)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035437-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TREX1
Alternative Gene Name: AGS1, DRN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000105383: 81%, ENSRNOG00000022540: 78%
Entrez Gene ID: 11277
Uniprot ID: Q9NSU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD |
| Gene Sequence | PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD |
| Gene ID - Mouse | ENSMUSG00000105383 |
| Gene ID - Rat | ENSRNOG00000022540 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TREX1 pAb (ATL-HPA035437) | |
| Datasheet | Anti TREX1 pAb (ATL-HPA035437) Datasheet (External Link) |
| Vendor Page | Anti TREX1 pAb (ATL-HPA035437) at Atlas Antibodies |
| Documents & Links for Anti TREX1 pAb (ATL-HPA035437) | |
| Datasheet | Anti TREX1 pAb (ATL-HPA035437) Datasheet (External Link) |
| Vendor Page | Anti TREX1 pAb (ATL-HPA035437) |
| Citations for Anti TREX1 pAb (ATL-HPA035437) – 1 Found |
| Kumar, Swati; Morrison, James H; Dingli, David; Poeschla, Eric. HIV-1 Activation of Innate Immunity Depends Strongly on the Intracellular Level of TREX1 and Sensing of Incomplete Reverse Transcription Products. Journal Of Virology. 2018;92(16) PubMed |