Anti TREX1 pAb (ATL-HPA035437)

Atlas Antibodies

Catalog No.: ATL-HPA035437-25

Protein Description: three prime repair exonuclease 1
Gene Name: TREX1
Alternative Gene Name: AGS1, DRN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000105383: 81%, ENSRNOG00000022540: 78%
Entrez Gene ID: 11277
Uniprot ID: Q9NSU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD
• Gene Sequence: PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD
• Gene ID - Mouse: ENSMUSG00000105383
• Gene ID - Rat: ENSRNOG00000022540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TREX1 pAb (ATL-HPA035437) – 1 Found

Kumar, Swati; Morrison, James H; Dingli, David; Poeschla, Eric. HIV-1 Activation of Innate Immunity Depends Strongly on the Intracellular Level of TREX1 and Sensing of Incomplete Reverse Transcription Products. Journal Of Virology. 2018;92(16)