Anti TRAK2 pAb (ATL-HPA062163)

Atlas Antibodies

SKU: ATL-HPA062163-25

• 

Protein Description: trafficking protein, kinesin binding 2
Gene Name: TRAK2
Alternative Gene Name: ALS2CR3, CALS-C, GRIF-1, KIAA0549, MILT2, OIP98
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026028: 79%, ENSRNOG00000010881: 78%
Entrez Gene ID: 66008
Uniprot ID: O60296
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEEEGITFQVQQPLEVEEKLSTSKPVTGIFLPPITSAGGPVTVATANPGKCLSCTNST
• Gene Sequence: DEEEGITFQVQQPLEVEEKLSTSKPVTGIFLPPITSAGGPVTVATANPGKCLSCTNST
• Gene ID - Mouse: ENSMUSG00000026028
• Gene ID - Rat: ENSRNOG00000010881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.