Anti TPR pAb (ATL-HPA019661 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019661-25

Protein Description: translocated promoter region, nuclear basket protein
Gene Name: TPR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006005: 88%, ENSRNOG00000002394: 90%
Entrez Gene ID: 7175
Uniprot ID: P12270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQE
• Gene Sequence: KMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQE
• Gene ID - Mouse: ENSMUSG00000006005
• Gene ID - Rat: ENSRNOG00000002394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPR pAb (ATL-HPA019661 w/enhanced validation) – 2 Found

Cortini, Margherita; Armirotti, Andrea; Columbaro, Marta; Longo, Dario Livio; Di Pompo, Gemma; Cannas, Elena; Maresca, Alessandra; Errani, Costantino; Longhi, Alessandra; Righi, Alberto; Carelli, Valerio; Baldini, Nicola; Avnet, Sofia. Exploring Metabolic Adaptations to the Acidic Microenvironment of Osteosarcoma Cells Unveils Sphingosine 1-Phosphate as a Valuable Therapeutic Target. Cancers. 2021;13(2) 

Otsuka, Shotaro; Tempkin, Jeremy O B; Zhang, Wanlu; Politi, Antonio Z; Rybina, Arina; Hossain, M Julius; Kueblbeck, Moritz; Callegari, Andrea; Koch, Birgit; Morero, Natalia Rosalia; Sali, Andrej; Ellenberg, Jan. A quantitative map of nuclear pore assembly reveals two distinct mechanisms. Nature. 2023;613(7944):575-581.