Anti TPPP pAb (ATL-HPA036575 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036575-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tubulin polymerization promoting protein
Gene Name: TPPP
Alternative Gene Name: p25, p25alpha, TPPP/p25, TPPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021573: 90%, ENSRNOG00000028261: 92%
Entrez Gene ID: 11076
Uniprot ID: O94811
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLC
Gene Sequence SLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLC
Gene ID - Mouse ENSMUSG00000021573
Gene ID - Rat ENSRNOG00000028261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TPPP pAb (ATL-HPA036575 w/enhanced validation)
Datasheet Anti TPPP pAb (ATL-HPA036575 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPPP pAb (ATL-HPA036575 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TPPP pAb (ATL-HPA036575 w/enhanced validation)
Datasheet Anti TPPP pAb (ATL-HPA036575 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPPP pAb (ATL-HPA036575 w/enhanced validation)