Anti TPM1 pAb (ATL-HPA000261)

Atlas Antibodies

Catalog No.: ATL-HPA000261-25

Protein Description: tropomyosin 1 (alpha)
Gene Name: TPM1
Alternative Gene Name: C15orf13, CMH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032366: 99%, ENSRNOG00000018184: 99%
Entrez Gene ID: 7168
Uniprot ID: P09493
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAE
• Gene Sequence: KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAE
• Gene ID - Mouse: ENSMUSG00000032366
• Gene ID - Rat: ENSRNOG00000018184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPM1 pAb (ATL-HPA000261) – 1 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.