Anti TPD52L1 pAb (ATL-HPA027915)

Atlas Antibodies

Catalog No.: ATL-HPA027915-100

Protein Description: tumor protein D52-like 1
Gene Name: TPD52L1
Alternative Gene Name: D53, hD53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000296: 80%, ENSRNOG00000021478: 82%
Entrez Gene ID: 7164
Uniprot ID: Q16890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
• Gene Sequence: SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
• Gene ID - Mouse: ENSMUSG00000000296
• Gene ID - Rat: ENSRNOG00000021478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.