Anti TPD52L1 pAb (ATL-HPA027915)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027915-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TPD52L1
Alternative Gene Name: D53, hD53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000296: 80%, ENSRNOG00000021478: 82%
Entrez Gene ID: 7164
Uniprot ID: Q16890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC |
| Gene Sequence | SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC |
| Gene ID - Mouse | ENSMUSG00000000296 |
| Gene ID - Rat | ENSRNOG00000021478 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TPD52L1 pAb (ATL-HPA027915) | |
| Datasheet | Anti TPD52L1 pAb (ATL-HPA027915) Datasheet (External Link) |
| Vendor Page | Anti TPD52L1 pAb (ATL-HPA027915) at Atlas Antibodies |
| Documents & Links for Anti TPD52L1 pAb (ATL-HPA027915) | |
| Datasheet | Anti TPD52L1 pAb (ATL-HPA027915) Datasheet (External Link) |
| Vendor Page | Anti TPD52L1 pAb (ATL-HPA027915) |