Anti TP73 pAb (ATL-HPA044516)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044516-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: TP73
Alternative Gene Name: P73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029026: 66%, ENSRNOG00000024707: 72%
Entrez Gene ID: 7161
Uniprot ID: O15350
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMS |
| Gene Sequence | ATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMS |
| Gene ID - Mouse | ENSMUSG00000029026 |
| Gene ID - Rat | ENSRNOG00000024707 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TP73 pAb (ATL-HPA044516) | |
| Datasheet | Anti TP73 pAb (ATL-HPA044516) Datasheet (External Link) |
| Vendor Page | Anti TP73 pAb (ATL-HPA044516) at Atlas Antibodies |
| Documents & Links for Anti TP73 pAb (ATL-HPA044516) | |
| Datasheet | Anti TP73 pAb (ATL-HPA044516) Datasheet (External Link) |
| Vendor Page | Anti TP73 pAb (ATL-HPA044516) |