Anti TOR1B pAb (ATL-HPA013403)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013403-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOR1B
Alternative Gene Name: DQ1, MGC4386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026848: 93%, ENSRNOG00000006435: 93%
Entrez Gene ID: 27348
Uniprot ID: O14657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH |
| Gene Sequence | LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH |
| Gene ID - Mouse | ENSMUSG00000026848 |
| Gene ID - Rat | ENSRNOG00000006435 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOR1B pAb (ATL-HPA013403) | |
| Datasheet | Anti TOR1B pAb (ATL-HPA013403) Datasheet (External Link) |
| Vendor Page | Anti TOR1B pAb (ATL-HPA013403) at Atlas Antibodies |
| Documents & Links for Anti TOR1B pAb (ATL-HPA013403) | |
| Datasheet | Anti TOR1B pAb (ATL-HPA013403) Datasheet (External Link) |
| Vendor Page | Anti TOR1B pAb (ATL-HPA013403) |