Anti TOR1B pAb (ATL-HPA013403)

Atlas Antibodies

Catalog No.:
ATL-HPA013403-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: torsin family 1, member B (torsin B)
Gene Name: TOR1B
Alternative Gene Name: DQ1, MGC4386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026848: 93%, ENSRNOG00000006435: 93%
Entrez Gene ID: 27348
Uniprot ID: O14657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH
Gene Sequence LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH
Gene ID - Mouse ENSMUSG00000026848
Gene ID - Rat ENSRNOG00000006435
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOR1B pAb (ATL-HPA013403)
Datasheet Anti TOR1B pAb (ATL-HPA013403) Datasheet (External Link)
Vendor Page Anti TOR1B pAb (ATL-HPA013403) at Atlas Antibodies

Documents & Links for Anti TOR1B pAb (ATL-HPA013403)
Datasheet Anti TOR1B pAb (ATL-HPA013403) Datasheet (External Link)
Vendor Page Anti TOR1B pAb (ATL-HPA013403)