Anti TOR1B pAb (ATL-HPA013403)

Atlas Antibodies

Catalog No.: ATL-HPA013403-25

Protein Description: torsin family 1, member B (torsin B)
Gene Name: TOR1B
Alternative Gene Name: DQ1, MGC4386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026848: 93%, ENSRNOG00000006435: 93%
Entrez Gene ID: 27348
Uniprot ID: O14657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH
• Gene Sequence: LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH
• Gene ID - Mouse: ENSMUSG00000026848
• Gene ID - Rat: ENSRNOG00000006435
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.