Anti TOPBP1 pAb (ATL-HPA036739)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036739-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TOPBP1
Alternative Gene Name: KIAA0259, TOP2BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032555: 72%, ENSRNOG00000009789: 73%
Entrez Gene ID: 11073
Uniprot ID: Q92547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVTEAPKHPISEELETP |
| Gene Sequence | TVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVTEAPKHPISEELETP |
| Gene ID - Mouse | ENSMUSG00000032555 |
| Gene ID - Rat | ENSRNOG00000009789 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TOPBP1 pAb (ATL-HPA036739) | |
| Datasheet | Anti TOPBP1 pAb (ATL-HPA036739) Datasheet (External Link) |
| Vendor Page | Anti TOPBP1 pAb (ATL-HPA036739) at Atlas Antibodies |
| Documents & Links for Anti TOPBP1 pAb (ATL-HPA036739) | |
| Datasheet | Anti TOPBP1 pAb (ATL-HPA036739) Datasheet (External Link) |
| Vendor Page | Anti TOPBP1 pAb (ATL-HPA036739) |