Anti TOPBP1 pAb (ATL-HPA036739)

Atlas Antibodies

Catalog No.: ATL-HPA036739-25

Protein Description: topoisomerase (DNA) II binding protein 1
Gene Name: TOPBP1
Alternative Gene Name: KIAA0259, TOP2BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032555: 72%, ENSRNOG00000009789: 73%
Entrez Gene ID: 11073
Uniprot ID: Q92547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVTEAPKHPISEELETP
• Gene Sequence: TVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVTEAPKHPISEELETP
• Gene ID - Mouse: ENSMUSG00000032555
• Gene ID - Rat: ENSRNOG00000009789
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.