Anti TOPBP1 pAb (ATL-HPA036738)

Atlas Antibodies

Catalog No.:
ATL-HPA036738-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: topoisomerase (DNA) II binding protein 1
Gene Name: TOPBP1
Alternative Gene Name: KIAA0259, TOP2BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032555: 68%, ENSRNOG00000009789: 66%
Entrez Gene ID: 11073
Uniprot ID: Q92547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTPLDMNRFQSKAFRAVVS
Gene Sequence KYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTPLDMNRFQSKAFRAVVS
Gene ID - Mouse ENSMUSG00000032555
Gene ID - Rat ENSRNOG00000009789
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOPBP1 pAb (ATL-HPA036738)
Datasheet Anti TOPBP1 pAb (ATL-HPA036738) Datasheet (External Link)
Vendor Page Anti TOPBP1 pAb (ATL-HPA036738) at Atlas Antibodies

Documents & Links for Anti TOPBP1 pAb (ATL-HPA036738)
Datasheet Anti TOPBP1 pAb (ATL-HPA036738) Datasheet (External Link)
Vendor Page Anti TOPBP1 pAb (ATL-HPA036738)