Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024120-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: topoisomerase (DNA) II beta 180kDa
Gene Name: TOP2B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017485: 89%, ENSRNOG00000053047: 40%
Entrez Gene ID: 7155
Uniprot ID: Q02880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
Gene Sequence LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
Gene ID - Mouse ENSMUSG00000017485
Gene ID - Rat ENSRNOG00000053047
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation)
Datasheet Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation)
Datasheet Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation)
Citations for Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation) – 4 Found
Aviner, Ranen; Shenoy, Anjana; Elroy-Stein, Orna; Geiger, Tamar. Uncovering Hidden Layers of Cell Cycle Regulation through Integrative Multi-omic Analysis. Plos Genetics. 2015;11(10):e1005554.  PubMed
Zhang, Miao; Liang, Cai; Chen, Qinfu; Yan, Haiyan; Xu, Junfen; Zhao, Hongxia; Yuan, Xueying; Liu, Jingbo; Lin, Shixian; Lu, Weiguo; Wang, Fangwei. Histone H2A phosphorylation recruits topoisomerase IIα to centromeres to safeguard genomic stability. The Embo Journal. 2020;39(3):e101863.  PubMed
Martínez-García, Pedro Manuel; García-Torres, Miguel; Divina, Federico; Terrón-Bautista, José; Delgado-Sainz, Irene; Gómez-Vela, Francisco; Cortés-Ledesma, Felipe. Genome-wide prediction of topoisomerase IIβ binding by architectural factors and chromatin accessibility. Plos Computational Biology. 2021;17(1):e1007814.  PubMed
Zhang, Doudou; Shimokawa, Takashi; Guo, Qianqian; Dan, Shingo; Miki, Yoshio; Sunada, Shigeaki. Discovery of novel DNA-damaging agents through phenotypic screening for DNA double-strand break. Cancer Science. 2023;114(3):1108-1117.  PubMed