Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024120-25

Protein Description: topoisomerase (DNA) II beta 180kDa
Gene Name: TOP2B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017485: 89%, ENSRNOG00000053047: 40%
Entrez Gene ID: 7155
Uniprot ID: Q02880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
• Gene Sequence: LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
• Gene ID - Mouse: ENSMUSG00000017485
• Gene ID - Rat: ENSRNOG00000053047
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TOP2B pAb (ATL-HPA024120 w/enhanced validation) – 4 Found

Aviner, Ranen; Shenoy, Anjana; Elroy-Stein, Orna; Geiger, Tamar. Uncovering Hidden Layers of Cell Cycle Regulation through Integrative Multi-omic Analysis. Plos Genetics. 2015;11(10):e1005554. 

Zhang, Miao; Liang, Cai; Chen, Qinfu; Yan, Haiyan; Xu, Junfen; Zhao, Hongxia; Yuan, Xueying; Liu, Jingbo; Lin, Shixian; Lu, Weiguo; Wang, Fangwei. Histone H2A phosphorylation recruits topoisomerase IIα to centromeres to safeguard genomic stability. The Embo Journal. 2020;39(3):e101863. 

Martínez-García, Pedro Manuel; García-Torres, Miguel; Divina, Federico; Terrón-Bautista, José; Delgado-Sainz, Irene; Gómez-Vela, Francisco; Cortés-Ledesma, Felipe. Genome-wide prediction of topoisomerase IIβ binding by architectural factors and chromatin accessibility. Plos Computational Biology. 2021;17(1):e1007814. 

Zhang, Doudou; Shimokawa, Takashi; Guo, Qianqian; Dan, Shingo; Miki, Yoshio; Sunada, Shigeaki. Discovery of novel DNA-damaging agents through phenotypic screening for DNA double-strand break. Cancer Science. 2023;114(3):1108-1117.