Anti TOP1MT pAb (ATL-HPA001915)

Atlas Antibodies

SKU:
ATL-HPA001915-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: topoisomerase (DNA) I, mitochondrial
Gene Name: TOP1MT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000934: 82%, ENSRNOG00000007500: 83%
Entrez Gene ID: 116447
Uniprot ID: Q969P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYCILDGHQEKIGNFKIEPPGLFRGRGDHPKMGMLKRRITPEDVVINCSRDSKIPEPPAGHQWKEVRSDNTVTWLAAWTESVQNSIKYIMLNPCSKLKGETAWQKFETARRLRGFVDEIRSQYRADWKSREMKTRQ
Gene Sequence GYCILDGHQEKIGNFKIEPPGLFRGRGDHPKMGMLKRRITPEDVVINCSRDSKIPEPPAGHQWKEVRSDNTVTWLAAWTESVQNSIKYIMLNPCSKLKGETAWQKFETARRLRGFVDEIRSQYRADWKSREMKTRQ
Gene ID - Mouse ENSMUSG00000000934
Gene ID - Rat ENSRNOG00000007500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TOP1MT pAb (ATL-HPA001915)
Datasheet Anti TOP1MT pAb (ATL-HPA001915) Datasheet (External Link)
Vendor Page Anti TOP1MT pAb (ATL-HPA001915) at Atlas Antibodies

Documents & Links for Anti TOP1MT pAb (ATL-HPA001915)
Datasheet Anti TOP1MT pAb (ATL-HPA001915) Datasheet (External Link)
Vendor Page Anti TOP1MT pAb (ATL-HPA001915)



Citations for Anti TOP1MT pAb (ATL-HPA001915) – 1 Found
Nicholls, Thomas J; Nadalutti, Cristina A; Motori, Elisa; Sommerville, Ewen W; Gorman, Gráinne S; Basu, Swaraj; Hoberg, Emily; Turnbull, Doug M; Chinnery, Patrick F; Larsson, Nils-Göran; Larsson, Erik; Falkenberg, Maria; Taylor, Robert W; Griffith, Jack D; Gustafsson, Claes M. Topoisomerase 3α Is Required for Decatenation and Segregation of Human mtDNA. Molecular Cell. 2018;69(1):9-23.e6.  PubMed