Anti TOMM70 pAb (ATL-HPA048020)

Atlas Antibodies

SKU: ATL-HPA048020-25

• 
• 
• 

Protein Description: translocase of outer mitochondrial membrane 70
Gene Name: TOMM70
Alternative Gene Name: KIAA0719, Tom70, TOMM70A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022752: 98%, ENSRNOG00000001640: 98%
Entrez Gene ID: 9868
Uniprot ID: O94826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS
• Gene Sequence: YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS
• Gene ID - Mouse: ENSMUSG00000022752
• Gene ID - Rat: ENSRNOG00000001640
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.