Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA011562-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: translocase of outer mitochondrial membrane 20 homolog (yeast)
Gene Name: TOMM20
Alternative Gene Name: KIAA0016, MAS20, MOM19, TOM20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093904: 99%, ENSRNOG00000019980: 99%
Entrez Gene ID: 9804
Uniprot ID: Q15388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
Gene Sequence KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
Gene ID - Mouse ENSMUSG00000093904
Gene ID - Rat ENSRNOG00000019980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation)
Datasheet Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation)
Datasheet Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation)
Citations for Anti TOMM20 pAb (ATL-HPA011562 w/enhanced validation) – 32 Found
Denuc, Amanda; Núñez, Estefanía; Calvo, Enrique; Loureiro, Marta; Miro-Casas, Elisabet; Guarás, Adela; Vázquez, Jesús; Garcia-Dorado, David. New protein-protein interactions of mitochondrial connexin 43 in mouse heart. Journal Of Cellular And Molecular Medicine. 2016;20(5):794-803.  PubMed
Taggart, Kathryn; Estrada, Amara; Thompson, Patrick; Lourenco, Francisco; Kirmani, Sara; Suzuki-Hatano, Silveli; Pacak, Christina A. PDK4 Deficiency Induces Intrinsic Apoptosis in Response to Starvation in Fibroblasts from Doberman Pinschers with Dilated Cardiomyopathy. Bioresearch Open Access. 6(1):182-191.  PubMed
Saita, Shotaro; Tatsuta, Takashi; Lampe, Philipp A; König, Tim; Ohba, Yohsuke; Langer, Thomas. PARL partitions the lipid transfer protein STARD7 between the cytosol and mitochondria. The Embo Journal. 2018;37(4)  PubMed
Bernkopf, Dominic B; Jalal, Kowcee; Brückner, Martina; Knaup, Karl X; Gentzel, Marc; Schambony, Alexandra; Behrens, Jürgen. Pgam5 released from damaged mitochondria induces mitochondrial biogenesis via Wnt signaling. The Journal Of Cell Biology. 2018;217(4):1383-1394.  PubMed
Zeng, Ruixia; Fang, Yan; Zhang, Yibo; Bai, Shuling. p62 is linked to mitophagy in oleic acid-induced adipogenesis in human adipose-derived stromal cells. Lipids In Health And Disease. 2018;17(1):133.  PubMed
Marcassa, Elena; Kallinos, Andreas; Jardine, Jane; Rusilowicz-Jones, Emma V; Martinez, Aitor; Kuehl, Sandra; Islinger, Markus; Clague, Michael J; Urbé, Sylvie. Dual role of USP30 in controlling basal pexophagy and mitophagy. Embo Reports. 2018;19(7)  PubMed
Hangas, Anu; Aasumets, Koit; Kekäläinen, Nina J; Paloheinä, Mika; Pohjoismäki, Jaakko L; Gerhold, Joachim M; Goffart, Steffi. Ciprofloxacin impairs mitochondrial DNA replication initiation through inhibition of Topoisomerase 2. Nucleic Acids Research. 2018;46(18):9625-9636.  PubMed
Martorano, Laura; Peron, Margherita; Laquatra, Claudio; Lidron, Elisa; Facchinello, Nicola; Meneghetti, Giacomo; Tiso, Natascia; Rasola, Andrea; Ghezzi, Daniele; Argenton, Francesco. The zebrafish orthologue of the human hepatocerebral disease gene MPV17 plays pleiotropic roles in mitochondria. Disease Models & Mechanisms. 2019;12(3)  PubMed
Suzuki-Hatano, Silveli; Sriramvenugopal, Mughil; Ramanathan, Manash; Soustek, Meghan; Byrne, Barry J; Cade, W Todd; Kang, Peter B; Pacak, Christina A. Increased mtDNA Abundance and Improved Function in Human Barth Syndrome Patient Fibroblasts Following AAV-TAZ Gene Delivery. International Journal Of Molecular Sciences. 2019;20(14)  PubMed
Arguello, Tania; Peralta, Susana; Antonicka, Hana; Gaidosh, Gabriel; Diaz, Francisca; Tu, Ya-Ting; Garcia, Sofia; Shiekhattar, Ramin; Barrientos, Antonio; Moraes, Carlos T. ATAD3A has a scaffolding role regulating mitochondria inner membrane structure and protein assembly. Cell Reports. 2021;37(12):110139.  PubMed
Vultaggio-Poma, Valentina; Falzoni, Simonetta; Chiozzi, Paola; Sarti, Alba Clara; Adinolfi, Elena; Giuliani, Anna Lisa; Sánchez-Melgar, Alejandro; Boldrini, Paola; Zanoni, Michele; Tesei, Anna; Pinton, Paolo; Di Virgilio, Francesco. Extracellular ATP is increased by release of ATP-loaded microparticles triggered by nutrient deprivation. Theranostics. 12(2):859-874.  PubMed
Aass, Kristin Roseth; Mjelle, Robin; Kastnes, Martin H; Tryggestad, Synne S; van den Brink, Luca M; Aass Roseth, Ingrid; Westhrin, Marita; Zahoor, Muhammad; Moen, Siv H; Vikene Nedal, Tonje M; Buene, Glenn; Misund, Kristine; Sponaas, Anne-Marit; Ma, Qianli; Sundan, Anders; Groen, Richard Wj; Slørdahl, Tobias S; Waage, Anders; Standal, Therese. Intracellular IL-32 regulates mitochondrial metabolism, proliferation, and differentiation of malignant plasma cells. Iscience. 2022;25(1):103605.  PubMed
Zhang, Tan; Zhao, Jingyao; Liu, Tiemin; Cheng, Wei; Wang, Yibing; Ding, Shuzhe; Wang, Ru. A novel mechanism for NLRP3 inflammasome activation. Metabolism Open. 2022;13( 35198946):100166.  PubMed
Pietras, Łukasz; Stefanik, Ewa; Rakus, Dariusz; Gizak, Agnieszka. FBP2-A New Player in Regulation of Motility of Mitochondria and Stability of Microtubules in Cardiomyocytes. Cells. 2022;11(10)  PubMed
Wolf, Christina; Pouya, Alireza; Bitar, Sara; Pfeiffer, Annika; Bueno, Diones; Rojas-Charry, Liliana; Arndt, Sabine; Gomez-Zepeda, David; Tenzer, Stefan; Bello, Federica Dal; Vianello, Caterina; Ritz, Sandra; Schwirz, Jonas; Dobrindt, Kristina; Peitz, Michael; Hanschmann, Eva-Maria; Mencke, Pauline; Boussaad, Ibrahim; Silies, Marion; Brüstle, Oliver; Giacomello, Marta; Krüger, Rejko; Methner, Axel. GDAP1 loss of function inhibits the mitochondrial pyruvate dehydrogenase complex by altering the actin cytoskeleton. Communications Biology. 2022;5(1):541.  PubMed
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed
Weber, Tobias A; Koob, Sebastian; Heide, Heinrich; Wittig, Ilka; Head, Brian; van der Bliek, Alexander; Brandt, Ulrich; Mittelbronn, Michel; Reichert, Andreas S. APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria. Plos One. 8(5):e63683.  PubMed
Radif, Yassmeen; Ndiaye, Haarith; Kalantzi, Vasiliki; Jacobs, Ruth; Hall, Andrew; Minogue, Shane; Waugh, Mark G. The endogenous subcellular localisations of the long chain fatty acid-activating enzymes ACSL3 and ACSL4 in sarcoma and breast cancer cells. Molecular And Cellular Biochemistry. 2018;448(1-2):275-286.  PubMed
Ahmed, Maizbha U; Velkov, Tony; Zhou, Qi Tony; Fulcher, Alex J; Callaghan, Judy; Zhou, Fanfan; Chan, Kim; Azad, Mohammad A K; Li, Jian. Intracellular localization of polymyxins in human alveolar epithelial cells. The Journal Of Antimicrobial Chemotherapy. 2019;74(1):48-57.  PubMed
Machiraju, Pranav; Wang, Xuemei; Sabouny, Rasha; Huang, Joshua; Zhao, Tian; Iqbal, Fatima; King, Melissa; Prasher, Dimple; Lodha, Arijit; Jimenez-Tellez, Nerea; Ravandi, Amir; Argiropoulos, Bob; Sinasac, David; Khan, Aneal; Shutt, Timothy E; Greenway, Steven C. SS-31 Peptide Reverses the Mitochondrial Fragmentation Present in Fibroblasts From Patients With DCMA, a Mitochondrial Cardiomyopathy. Frontiers In Cardiovascular Medicine. 6( 31803760):167.  PubMed
Bolfer, Luiz; Estrada, Amara H; Larkin, Chelsea; Conlon, Thomas J; Lourenco, Francisco; Taggart, Kathryn; Suzuki-Hatano, Silveli; Pacak, Christina A. Functional Consequences of PDK4 Deficiency in Doberman Pinscher Fibroblasts. Scientific Reports. 2020;10(1):3930.  PubMed
Rusilowicz-Jones, Emma V; Jardine, Jane; Kallinos, Andreas; Pinto-Fernandez, Adan; Guenther, Franziska; Giurrandino, Mariacarmela; Barone, Francesco G; McCarron, Katy; Burke, Christopher J; Murad, Alejandro; Martinez, Aitor; Marcassa, Elena; Gersch, Malte; Buckmelter, Alexandre J; Kayser-Bricker, Katherine J; Lamoliatte, Frederic; Gajbhiye, Akshada; Davis, Simon; Scott, Hannah C; Murphy, Emma; England, Katherine; Mortiboys, Heather; Komander, David; Trost, Matthias; Kessler, Benedikt M; Ioannidis, Stephanos; Ahlijanian, Michael K; Urbé, Sylvie; Clague, Michael J. USP30 sets a trigger threshold for PINK1-PARKIN amplification of mitochondrial ubiquitylation. Life Science Alliance. 2020;3(8)  PubMed
Wang, Zhefang; Qin, Jie; Zhao, Jiangang; Li, Jiahui; Li, Dai; Popp, Marie; Popp, Felix; Alakus, Hakan; Kong, Bo; Dong, Qiongzhu; Nelson, Peter J; Zhao, Yue; Bruns, Christiane J. Inflammatory IFIT3 renders chemotherapy resistance by regulating post-translational modification of VDAC2 in pancreatic cancer. Theranostics. 10(16):7178-7192.  PubMed
Keller, Florian; Bruch, Roman; Schneider, Richard; Meier-Hubberten, Julia; Hafner, Mathias; Rudolf, Rüdiger. A Scaffold-Free 3-D Co-Culture Mimics the Major Features of the Reverse Warburg Effect In Vitro. Cells. 2020;9(8)  PubMed
Hajka, Daria; Duda, Przemysław; Wójcicka, Olga; Drulis-Fajdasz, Dominika; Rakus, Dariusz; Gizak, Agnieszka. Expression of Fbp2, a Newly Discovered Constituent of Memory Formation Mechanisms, Is Regulated by Astrocyte-Neuron Crosstalk. International Journal Of Molecular Sciences. 2020;21(18)  PubMed
Fenzl, Anna; Kulterer, Oana Cristina; Spirk, Katrin; Mitulović, Goran; Marculescu, Rodrig; Bilban, Martin; Baumgartner-Parzer, Sabina; Kautzky-Willer, Alexandra; Kenner, Lukas; Plutzky, Jorge; Quadro, Loredana; Kiefer, Florian W. Intact vitamin A transport is critical for cold-mediated adipose tissue browning and thermogenesis. Molecular Metabolism. 2020;42( 32992038):101088.  PubMed
Li, Dunhui; Aung-Htut, May T; Ham, Kristin A; Fletcher, Sue; Wilton, Steve D. A Splice Intervention Therapy for Autosomal Recessive Juvenile Parkinson's Disease Arising from Parkin Mutations. International Journal Of Molecular Sciences. 2020;21(19)  PubMed
Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689.  PubMed
Bock, Theresa; Türk, Clara; Aravamudhan, Sriram; Keufgens, Lena; Bloch, Wilhelm; Rozsivalova, Dieu Hien; Romanello, Vanina; Nogara, Leonardo; Blaauw, Bert; Trifunovic, Aleksandra; Braun, Thomas; Krüger, Marcus. PERM1 interacts with the MICOS-MIB complex to connect the mitochondria and sarcolemma via ankyrin B. Nature Communications. 2021;12(1):4900.  PubMed
Al Khatib, Iman; Deng, Jingti; Symes, Andrew; Kerr, Marina; Zhang, Hongliang; Huang, Shar-Yin Naomi; Pommier, Yves; Khan, Aneal; Shutt, Timothy E. Functional characterization of two variants of mitochondrial topoisomerase TOP1MT that impact regulation of the mitochondrial genome. The Journal Of Biological Chemistry. 2022;298(10):102420.  PubMed
Bertholet, Ambre M; Natale, Andrew M; Bisignano, Paola; Suzuki, Junji; Fedorenko, Andriy; Hamilton, James; Brustovetsky, Tatiana; Kazak, Lawrence; Garrity, Ryan; Chouchani, Edward T; Brustovetsky, Nickolay; Grabe, Michael; Kirichok, Yuriy. Mitochondrial uncouplers induce proton leak by activating AAC and UCP1. Nature. 2022;606(7912):180-187.  PubMed
Barone, Francesco G; Urbé, Sylvie; Clague, Michael J. Segregation of pathways leading to pexophagy. Life Science Alliance. 2023;6(5)  PubMed