Anti TOB1 pAb (ATL-HPA047839)

Atlas Antibodies

Catalog No.: ATL-HPA047839-25

Protein Description: transducer of ERBB2, 1
Gene Name: TOB1
Alternative Gene Name: TOB, TROB, TROB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037573: 91%, ENSRNOG00000002828: 91%
Entrez Gene ID: 10140
Uniprot ID: P50616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ
• Gene Sequence: STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ
• Gene ID - Mouse: ENSMUSG00000037573
• Gene ID - Rat: ENSRNOG00000002828
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.