Anti TOB1 pAb (ATL-HPA047839)

Atlas Antibodies

Catalog No.:
ATL-HPA047839-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transducer of ERBB2, 1
Gene Name: TOB1
Alternative Gene Name: TOB, TROB, TROB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037573: 91%, ENSRNOG00000002828: 91%
Entrez Gene ID: 10140
Uniprot ID: P50616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ
Gene Sequence STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ
Gene ID - Mouse ENSMUSG00000037573
Gene ID - Rat ENSRNOG00000002828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TOB1 pAb (ATL-HPA047839)
Datasheet Anti TOB1 pAb (ATL-HPA047839) Datasheet (External Link)
Vendor Page Anti TOB1 pAb (ATL-HPA047839) at Atlas Antibodies

Documents & Links for Anti TOB1 pAb (ATL-HPA047839)
Datasheet Anti TOB1 pAb (ATL-HPA047839) Datasheet (External Link)
Vendor Page Anti TOB1 pAb (ATL-HPA047839)