Anti TNS1 pAb (ATL-HPA036090)

Atlas Antibodies

Catalog No.: ATL-HPA036090-25

Protein Description: tensin 1
Gene Name: TNS1
Alternative Gene Name: DKFZp586K0617, MXRA6, PPP1R155, TNS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055322: 98%, ENSRNOG00000014182: 99%
Entrez Gene ID: 7145
Uniprot ID: Q9HBL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK
• Gene Sequence: EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK
• Gene ID - Mouse: ENSMUSG00000055322
• Gene ID - Rat: ENSRNOG00000014182
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.