Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036089-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TNS1
Alternative Gene Name: DKFZp586K0617, MXRA6, PPP1R155, TNS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055322: 74%, ENSRNOG00000014182: 74%
Entrez Gene ID: 7145
Uniprot ID: Q9HBL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSPLTNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQS |
| Gene Sequence | LSPLTNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQS |
| Gene ID - Mouse | ENSMUSG00000055322 |
| Gene ID - Rat | ENSRNOG00000014182 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) | |
| Datasheet | Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) | |
| Datasheet | Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) |
| Citations for Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) – 3 Found |
| Shinde, Aparna; Paez, Juan Sebastian; Libring, Sarah; Hopkins, Kelsey; Solorio, Luis; Wendt, Michael K. Transglutaminase-2 facilitates extracellular vesicle-mediated establishment of the metastatic niche. Oncogenesis. 2020;9(2):16. PubMed |
| Mi, Bobin; Li, Qiushi; Li, Tong; Liu, Guohui; Sai, Jiayang. High miR-31-5p expression promotes colon adenocarcinoma progression by targeting TNS1. Aging. 2020;12(8):7480-7490. PubMed |
| Nizioł, Marcin; Zińczuk, Justyna; Zaręba, Konrad; Guzińska-Ustymowicz, Katarzyna; Pryczynicz, Anna. Immunohistochemical Analysis of the Expression of Adhesion Proteins: TNS1, TNS2 and TNS3 in Correlation with Clinicopathological Parameters in Gastric Cancer. Biomolecules. 2021;11(5) PubMed |