Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036089-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: tensin 1
Gene Name: TNS1
Alternative Gene Name: DKFZp586K0617, MXRA6, PPP1R155, TNS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055322: 74%, ENSRNOG00000014182: 74%
Entrez Gene ID: 7145
Uniprot ID: Q9HBL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSPLTNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQS
Gene Sequence LSPLTNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQS
Gene ID - Mouse ENSMUSG00000055322
Gene ID - Rat ENSRNOG00000014182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation)
Datasheet Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation)
Datasheet Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation)
Citations for Anti TNS1 pAb (ATL-HPA036089 w/enhanced validation) – 3 Found
Shinde, Aparna; Paez, Juan Sebastian; Libring, Sarah; Hopkins, Kelsey; Solorio, Luis; Wendt, Michael K. Transglutaminase-2 facilitates extracellular vesicle-mediated establishment of the metastatic niche. Oncogenesis. 2020;9(2):16.  PubMed
Mi, Bobin; Li, Qiushi; Li, Tong; Liu, Guohui; Sai, Jiayang. High miR-31-5p expression promotes colon adenocarcinoma progression by targeting TNS1. Aging. 2020;12(8):7480-7490.  PubMed
Nizioł, Marcin; Zińczuk, Justyna; Zaręba, Konrad; Guzińska-Ustymowicz, Katarzyna; Pryczynicz, Anna. Immunohistochemical Analysis of the Expression of Adhesion Proteins: TNS1, TNS2 and TNS3 in Correlation with Clinicopathological Parameters in Gastric Cancer. Biomolecules. 2021;11(5)  PubMed