Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044848-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TNNC1
Alternative Gene Name: TNNC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091898: 100%, ENSRNOG00000018943: 100%
Entrez Gene ID: 7134
Uniprot ID: P63316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM |
Gene Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM |
Gene ID - Mouse | ENSMUSG00000091898 |
Gene ID - Rat | ENSRNOG00000018943 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) | |
Datasheet | Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) | |
Datasheet | Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) |