Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044848-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: troponin C type 1 (slow)
Gene Name: TNNC1
Alternative Gene Name: TNNC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091898: 100%, ENSRNOG00000018943: 100%
Entrez Gene ID: 7134
Uniprot ID: P63316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM
Gene Sequence MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM
Gene ID - Mouse ENSMUSG00000091898
Gene ID - Rat ENSRNOG00000018943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation)
Datasheet Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation)
Datasheet Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC1 pAb (ATL-HPA044848 w/enhanced validation)