Anti TNK2 pAb (ATL-HPA041954)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041954-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TNK2
Alternative Gene Name: ACK, ACK1, p21cdc42Hs
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022791: 97%, ENSRNOG00000001769: 99%
Entrez Gene ID: 10188
Uniprot ID: Q07912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL |
| Gene Sequence | FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL |
| Gene ID - Mouse | ENSMUSG00000022791 |
| Gene ID - Rat | ENSRNOG00000001769 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNK2 pAb (ATL-HPA041954) | |
| Datasheet | Anti TNK2 pAb (ATL-HPA041954) Datasheet (External Link) |
| Vendor Page | Anti TNK2 pAb (ATL-HPA041954) at Atlas Antibodies |
| Documents & Links for Anti TNK2 pAb (ATL-HPA041954) | |
| Datasheet | Anti TNK2 pAb (ATL-HPA041954) Datasheet (External Link) |
| Vendor Page | Anti TNK2 pAb (ATL-HPA041954) |