Anti TNK2 pAb (ATL-HPA041954)

Atlas Antibodies

Catalog No.: ATL-HPA041954-25

Protein Description: tyrosine kinase, non-receptor, 2
Gene Name: TNK2
Alternative Gene Name: ACK, ACK1, p21cdc42Hs
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022791: 97%, ENSRNOG00000001769: 99%
Entrez Gene ID: 10188
Uniprot ID: Q07912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL
• Gene Sequence: FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL
• Gene ID - Mouse: ENSMUSG00000022791
• Gene ID - Rat: ENSRNOG00000001769
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.