Anti TNK1 pAb (ATL-HPA012065)

Atlas Antibodies

Catalog No.:
ATL-HPA012065-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tyrosine kinase, non-receptor, 1
Gene Name: TNK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001583: 71%, ENSRNOG00000015578: 76%
Entrez Gene ID: 8711
Uniprot ID: Q13470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG
Gene Sequence PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG
Gene ID - Mouse ENSMUSG00000001583
Gene ID - Rat ENSRNOG00000015578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNK1 pAb (ATL-HPA012065)
Datasheet Anti TNK1 pAb (ATL-HPA012065) Datasheet (External Link)
Vendor Page Anti TNK1 pAb (ATL-HPA012065) at Atlas Antibodies

Documents & Links for Anti TNK1 pAb (ATL-HPA012065)
Datasheet Anti TNK1 pAb (ATL-HPA012065) Datasheet (External Link)
Vendor Page Anti TNK1 pAb (ATL-HPA012065)