Anti TNIK pAb (ATL-HPA012297)

Atlas Antibodies

Catalog No.: ATL-HPA012297-25

Protein Description: TRAF2 and NCK interacting kinase
Gene Name: TNIK
Alternative Gene Name: KIAA0551
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027692: 94%, ENSRNOG00000012422: 94%
Entrez Gene ID: 23043
Uniprot ID: Q9UKE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLV
• Gene Sequence: AKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLV
• Gene ID - Mouse: ENSMUSG00000027692
• Gene ID - Rat: ENSRNOG00000012422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNIK pAb (ATL-HPA012297) – 1 Found

Burette, Alain C; Phend, Kristen D; Burette, Susan; Lin, Qingcong; Liang, Musen; Foltz, Gretchen; Taylor, Noël; Wang, Qi; Brandon, Nicholas J; Bates, Brian; Ehlers, Michael D; Weinberg, Richard J. Organization of TNIK in dendritic spines. The Journal Of Comparative Neurology. 2015;523(13):1913-24.