Anti TNIK pAb (ATL-HPA012128)

Atlas Antibodies

Catalog No.: ATL-HPA012128-25

Protein Description: TRAF2 and NCK interacting kinase
Gene Name: TNIK
Alternative Gene Name: KIAA0551
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027692: 99%, ENSRNOG00000012422: 99%
Entrez Gene ID: 23043
Uniprot ID: Q9UKE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS
• Gene Sequence: QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS
• Gene ID - Mouse: ENSMUSG00000027692
• Gene ID - Rat: ENSRNOG00000012422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNIK pAb (ATL-HPA012128) – 3 Found

Burette, Alain C; Phend, Kristen D; Burette, Susan; Lin, Qingcong; Liang, Musen; Foltz, Gretchen; Taylor, Noël; Wang, Qi; Brandon, Nicholas J; Bates, Brian; Ehlers, Michael D; Weinberg, Richard J. Organization of TNIK in dendritic spines. The Journal Of Comparative Neurology. 2015;523(13):1913-24. 

Yu, D-H; Zhang, X; Wang, H; Zhang, L; Chen, H; Hu, M; Dong, Z; Zhu, G; Qian, Z; Fan, J; Su, X; Xu, Y; Zheng, L; Dong, H; Yin, X; Ji, Q; Ji, J. The essential role of TNIK gene amplification in gastric cancer growth. Oncogenesis. 2014;2(2):e89. 

Takahashi, Hidenori; Ishikawa, Toshiaki; Ishiguro, Megumi; Okazaki, Satoshi; Mogushi, Kaoru; Kobayashi, Hirotoshi; Iida, Satoru; Mizushima, Hiroshi; Tanaka, Hiroshi; Uetake, Hiroyuki; Sugihara, Kenichi. Prognostic significance of Traf2- and Nck- interacting kinase (TNIK) in colorectal cancer. Bmc Cancer. 2015;15( 26499327):794.