Anti TNFSF15 pAb (ATL-HPA046522)

Atlas Antibodies

Catalog No.:
ATL-HPA046522-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tumor necrosis factor (ligand) superfamily, member 15
Gene Name: TNFSF15
Alternative Gene Name: MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050395: 61%, ENSRNOG00000008930: 64%
Entrez Gene ID: 9966
Uniprot ID: O95150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ
Gene Sequence QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ
Gene ID - Mouse ENSMUSG00000050395
Gene ID - Rat ENSRNOG00000008930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNFSF15 pAb (ATL-HPA046522)
Datasheet Anti TNFSF15 pAb (ATL-HPA046522) Datasheet (External Link)
Vendor Page Anti TNFSF15 pAb (ATL-HPA046522) at Atlas Antibodies

Documents & Links for Anti TNFSF15 pAb (ATL-HPA046522)
Datasheet Anti TNFSF15 pAb (ATL-HPA046522) Datasheet (External Link)
Vendor Page Anti TNFSF15 pAb (ATL-HPA046522)