Anti TNFSF15 pAb (ATL-HPA046522)

Atlas Antibodies

Catalog No.: ATL-HPA046522-25

Protein Description: tumor necrosis factor (ligand) superfamily, member 15
Gene Name: TNFSF15
Alternative Gene Name: MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050395: 61%, ENSRNOG00000008930: 64%
Entrez Gene ID: 9966
Uniprot ID: O95150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ
• Gene Sequence: QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ
• Gene ID - Mouse: ENSMUSG00000050395
• Gene ID - Rat: ENSRNOG00000008930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.