Anti TNFSF15 pAb (ATL-HPA046522)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046522-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TNFSF15
Alternative Gene Name: MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050395: 61%, ENSRNOG00000008930: 64%
Entrez Gene ID: 9966
Uniprot ID: O95150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ |
Gene Sequence | QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ |
Gene ID - Mouse | ENSMUSG00000050395 |
Gene ID - Rat | ENSRNOG00000008930 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TNFSF15 pAb (ATL-HPA046522) | |
Datasheet | Anti TNFSF15 pAb (ATL-HPA046522) Datasheet (External Link) |
Vendor Page | Anti TNFSF15 pAb (ATL-HPA046522) at Atlas Antibodies |
Documents & Links for Anti TNFSF15 pAb (ATL-HPA046522) | |
Datasheet | Anti TNFSF15 pAb (ATL-HPA046522) Datasheet (External Link) |
Vendor Page | Anti TNFSF15 pAb (ATL-HPA046522) |