Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014641-100

Protein Description: tumor necrosis factor, alpha-induced protein 1 (endothelial)
Gene Name: TNFAIP1
Alternative Gene Name: B12, B61, BTBD34, EDP1, MGC2317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017615: 99%, ENSRNOG00000009069: 97%
Entrez Gene ID: 7126
Uniprot ID: Q13829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD
• Gene Sequence: EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD
• Gene ID - Mouse: ENSMUSG00000017615
• Gene ID - Rat: ENSRNOG00000009069
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.