Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014641-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TNFAIP1
Alternative Gene Name: B12, B61, BTBD34, EDP1, MGC2317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017615: 99%, ENSRNOG00000009069: 97%
Entrez Gene ID: 7126
Uniprot ID: Q13829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD |
| Gene Sequence | EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD |
| Gene ID - Mouse | ENSMUSG00000017615 |
| Gene ID - Rat | ENSRNOG00000009069 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation) | |
| Datasheet | Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation) | |
| Datasheet | Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TNFAIP1 pAb (ATL-HPA014641 w/enhanced validation) |