Anti TNFAIP1 pAb (ATL-HPA013333)

Atlas Antibodies

Catalog No.:
ATL-HPA013333-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tumor necrosis factor, alpha-induced protein 1 (endothelial)
Gene Name: TNFAIP1
Alternative Gene Name: B12, B61, BTBD34, EDP1, MGC2317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017615: 92%, ENSRNOG00000009069: 91%
Entrez Gene ID: 7126
Uniprot ID: Q13829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYS
Gene Sequence FGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYS
Gene ID - Mouse ENSMUSG00000017615
Gene ID - Rat ENSRNOG00000009069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TNFAIP1 pAb (ATL-HPA013333)
Datasheet Anti TNFAIP1 pAb (ATL-HPA013333) Datasheet (External Link)
Vendor Page Anti TNFAIP1 pAb (ATL-HPA013333) at Atlas Antibodies

Documents & Links for Anti TNFAIP1 pAb (ATL-HPA013333)
Datasheet Anti TNFAIP1 pAb (ATL-HPA013333) Datasheet (External Link)
Vendor Page Anti TNFAIP1 pAb (ATL-HPA013333)