Anti TMX1 pAb (ATL-HPA003085)

Atlas Antibodies

Catalog No.: ATL-HPA003085-25

Protein Description: thioredoxin-related transmembrane protein 1
Gene Name: TMX1
Alternative Gene Name: PDIA11, TMX, TXNDC, TXNDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021072: 59%, ENSRNOG00000057934: 69%
Entrez Gene ID: 81542
Uniprot ID: Q9H3N1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
• Gene Sequence: RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
• Gene ID - Mouse: ENSMUSG00000021072
• Gene ID - Rat: ENSRNOG00000057934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMX1 pAb (ATL-HPA003085) – 1 Found

Matsuo, Yoshiyuki; Hirota, Kiichi. Transmembrane thioredoxin-related protein TMX1 is reversibly oxidized in response to protein accumulation in the endoplasmic reticulum. Febs Open Bio. 2017;7(11):1768-1777.