Anti TMTC2 pAb (ATL-HPA026955)

Atlas Antibodies

Catalog No.: ATL-HPA026955-25

Protein Description: transmembrane and tetratricopeptide repeat containing 2
Gene Name: TMTC2
Alternative Gene Name: DKFZp762A217
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036019: 81%, ENSRNOG00000004585: 83%
Entrez Gene ID: 160335
Uniprot ID: Q8N394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSPSVDRECNGKTVTNGKQNANGHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTEN
• Gene Sequence: KSPSVDRECNGKTVTNGKQNANGHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTEN
• Gene ID - Mouse: ENSMUSG00000036019
• Gene ID - Rat: ENSRNOG00000004585
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.