Anti TMEM61 pAb (ATL-HPA030614 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030614-25

Protein Description: transmembrane protein 61
Gene Name: TMEM61
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048029: 27%, ENSRNOG00000026594: 44%
Entrez Gene ID: 199964
Uniprot ID: Q8N0U2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG
• Gene Sequence: PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG
• Gene ID - Mouse: ENSMUSG00000048029
• Gene ID - Rat: ENSRNOG00000026594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.