Anti TMEM43 pAb (ATL-HPA019198)

Atlas Antibodies

Catalog No.: ATL-HPA019198-25

Protein Description: transmembrane protein 43
Gene Name: TMEM43
Alternative Gene Name: ARVD5, DKFZp586G1919, LUMA, MGC3222
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030095: 92%, ENSRNOG00000007519: 92%
Entrez Gene ID: 79188
Uniprot ID: Q9BTV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMKT
• Gene Sequence: FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMKT
• Gene ID - Mouse: ENSMUSG00000030095
• Gene ID - Rat: ENSRNOG00000007519
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM43 pAb (ATL-HPA019198) – 1 Found

Christensen, A H; Andersen, C B; Tybjaerg-Hansen, A; Haunso, S; Svendsen, J H. Mutation analysis and evaluation of the cardiac localization of TMEM43 in arrhythmogenic right ventricular cardiomyopathy. Clinical Genetics. 2011;80(3):256-64.