Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044889-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TMEM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024754: 71%, ENSRNOG00000012782: 71%
Entrez Gene ID: 23670
Uniprot ID: Q9UHN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATFAFSPEEQQAQ |
| Gene Sequence | YATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATFAFSPEEQQAQ |
| Gene ID - Mouse | ENSMUSG00000024754 |
| Gene ID - Rat | ENSRNOG00000012782 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) | |
| Datasheet | Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) | |
| Datasheet | Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) |
| Citations for Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) – 2 Found |
| Hogan, Marie C; Bakeberg, Jason L; Gainullin, Vladimir G; Irazabal, Maria V; Harmon, Amber J; Lieske, John C; Charlesworth, M Cristine; Johnson, Kenneth L; Madden, Benjamin J; Zenka, Roman M; McCormick, Daniel J; Sundsbak, Jamie L; Heyer, Christina M; Torres, Vicente E; Harris, Peter C; Ward, Christopher J. Identification of Biomarkers for PKD1 Using Urinary Exosomes. Journal Of The American Society Of Nephrology : Jasn. 2015;26(7):1661-70. PubMed |
| Lea, Wendy A; McGreal, Kerri; Sharma, Madhulika; Parnell, Stephen C; Zelenchuk, Lesya; Charlesworth, M Cristine; Madden, Benjamin J; Johnson, Kenneth L; McCormick, Daniel J; Hogan, Marie C; Ward, Christopher J. Analysis of the polycystin complex (PCC) in human urinary exosome-like vesicles (ELVs). Scientific Reports. 2020;10(1):1500. PubMed |