Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044889-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 2
Gene Name: TMEM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024754: 71%, ENSRNOG00000012782: 71%
Entrez Gene ID: 23670
Uniprot ID: Q9UHN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATFAFSPEEQQAQ
Gene Sequence YATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATFAFSPEEQQAQ
Gene ID - Mouse ENSMUSG00000024754
Gene ID - Rat ENSRNOG00000012782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation)
Datasheet Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation)
Datasheet Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation)
Citations for Anti TMEM2 pAb (ATL-HPA044889 w/enhanced validation) – 2 Found
Hogan, Marie C; Bakeberg, Jason L; Gainullin, Vladimir G; Irazabal, Maria V; Harmon, Amber J; Lieske, John C; Charlesworth, M Cristine; Johnson, Kenneth L; Madden, Benjamin J; Zenka, Roman M; McCormick, Daniel J; Sundsbak, Jamie L; Heyer, Christina M; Torres, Vicente E; Harris, Peter C; Ward, Christopher J. Identification of Biomarkers for PKD1 Using Urinary Exosomes. Journal Of The American Society Of Nephrology : Jasn. 2015;26(7):1661-70.  PubMed
Lea, Wendy A; McGreal, Kerri; Sharma, Madhulika; Parnell, Stephen C; Zelenchuk, Lesya; Charlesworth, M Cristine; Madden, Benjamin J; Johnson, Kenneth L; McCormick, Daniel J; Hogan, Marie C; Ward, Christopher J. Analysis of the polycystin complex (PCC) in human urinary exosome-like vesicles (ELVs). Scientific Reports. 2020;10(1):1500.  PubMed