Anti TMEM184C pAb (ATL-HPA054013)

Atlas Antibodies

Catalog No.:
ATL-HPA054013-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 184C
Gene Name: TMEM184C
Alternative Gene Name: FLJ10846, TMEM34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031617: 45%, ENSRNOG00000012860: 40%
Entrez Gene ID: 55751
Uniprot ID: Q9NVA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVD
Gene Sequence LSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVD
Gene ID - Mouse ENSMUSG00000031617
Gene ID - Rat ENSRNOG00000012860
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM184C pAb (ATL-HPA054013)
Datasheet Anti TMEM184C pAb (ATL-HPA054013) Datasheet (External Link)
Vendor Page Anti TMEM184C pAb (ATL-HPA054013) at Atlas Antibodies

Documents & Links for Anti TMEM184C pAb (ATL-HPA054013)
Datasheet Anti TMEM184C pAb (ATL-HPA054013) Datasheet (External Link)
Vendor Page Anti TMEM184C pAb (ATL-HPA054013)