Anti TMEM184C pAb (ATL-HPA054013)

Atlas Antibodies

Catalog No.: ATL-HPA054013-25

Protein Description: transmembrane protein 184C
Gene Name: TMEM184C
Alternative Gene Name: FLJ10846, TMEM34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031617: 45%, ENSRNOG00000012860: 40%
Entrez Gene ID: 55751
Uniprot ID: Q9NVA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVD
• Gene Sequence: LSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVD
• Gene ID - Mouse: ENSMUSG00000031617
• Gene ID - Rat: ENSRNOG00000012860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.