Anti TMEM159 pAb (ATL-HPA018033)

Atlas Antibodies

Catalog No.:
ATL-HPA018033-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 159
Gene Name: TMEM159
Alternative Gene Name: promethin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030917: 80%, ENSRNOG00000048250: 80%
Entrez Gene ID: 57146
Uniprot ID: Q96B96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQY
Gene Sequence MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQY
Gene ID - Mouse ENSMUSG00000030917
Gene ID - Rat ENSRNOG00000048250
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM159 pAb (ATL-HPA018033)
Datasheet Anti TMEM159 pAb (ATL-HPA018033) Datasheet (External Link)
Vendor Page Anti TMEM159 pAb (ATL-HPA018033) at Atlas Antibodies

Documents & Links for Anti TMEM159 pAb (ATL-HPA018033)
Datasheet Anti TMEM159 pAb (ATL-HPA018033) Datasheet (External Link)
Vendor Page Anti TMEM159 pAb (ATL-HPA018033)