Anti TMEM116 pAb (ATL-HPA040720)

Atlas Antibodies

Catalog No.:
ATL-HPA040720-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 116
Gene Name: TMEM116
Alternative Gene Name: FLJ90167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029452: 74%, ENSRNOG00000027480: 62%
Entrez Gene ID: 89894
Uniprot ID: Q8NCL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNTSECFQNFSQSHKCILMHSPPSAMAELPPSANTSVCS
Gene Sequence GNTSECFQNFSQSHKCILMHSPPSAMAELPPSANTSVCS
Gene ID - Mouse ENSMUSG00000029452
Gene ID - Rat ENSRNOG00000027480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM116 pAb (ATL-HPA040720)
Datasheet Anti TMEM116 pAb (ATL-HPA040720) Datasheet (External Link)
Vendor Page Anti TMEM116 pAb (ATL-HPA040720) at Atlas Antibodies

Documents & Links for Anti TMEM116 pAb (ATL-HPA040720)
Datasheet Anti TMEM116 pAb (ATL-HPA040720) Datasheet (External Link)
Vendor Page Anti TMEM116 pAb (ATL-HPA040720)