Anti TMEM116 pAb (ATL-HPA040720)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040720-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: TMEM116
Alternative Gene Name: FLJ90167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029452: 74%, ENSRNOG00000027480: 62%
Entrez Gene ID: 89894
Uniprot ID: Q8NCL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNTSECFQNFSQSHKCILMHSPPSAMAELPPSANTSVCS |
| Gene Sequence | GNTSECFQNFSQSHKCILMHSPPSAMAELPPSANTSVCS |
| Gene ID - Mouse | ENSMUSG00000029452 |
| Gene ID - Rat | ENSRNOG00000027480 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM116 pAb (ATL-HPA040720) | |
| Datasheet | Anti TMEM116 pAb (ATL-HPA040720) Datasheet (External Link) |
| Vendor Page | Anti TMEM116 pAb (ATL-HPA040720) at Atlas Antibodies |
| Documents & Links for Anti TMEM116 pAb (ATL-HPA040720) | |
| Datasheet | Anti TMEM116 pAb (ATL-HPA040720) Datasheet (External Link) |
| Vendor Page | Anti TMEM116 pAb (ATL-HPA040720) |