Anti TMEM115 pAb (ATL-HPA015497)

Atlas Antibodies

Catalog No.: ATL-HPA015497-25

Protein Description: transmembrane protein 115
Gene Name: TMEM115
Alternative Gene Name: PL6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010045: 88%, ENSRNOG00000021899: 91%
Entrez Gene ID: 11070
Uniprot ID: Q12893
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF
• Gene Sequence: KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF
• Gene ID - Mouse: ENSMUSG00000010045
• Gene ID - Rat: ENSRNOG00000021899
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM115 pAb (ATL-HPA015497) – 1 Found

Ong, Yan Shan; Tran, Ton Hoai Thi; Gounko, Natalia V; Hong, Wanjin. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport. Journal Of Cell Science. 2014;127(Pt 13):2825-39.