Anti TMEM100 pAb (ATL-HPA055936)

Atlas Antibodies

Catalog No.: ATL-HPA055936-25

Protein Description: transmembrane protein 100
Gene Name: TMEM100
Alternative Gene Name: FLJ10970, FLJ37856
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069763: 72%, ENSRNOG00000002434: 77%
Entrez Gene ID: 55273
Uniprot ID: Q9NV29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG
• Gene Sequence: MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG
• Gene ID - Mouse: ENSMUSG00000069763
• Gene ID - Rat: ENSRNOG00000002434
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.