Anti TMEM100 pAb (ATL-HPA055936)

Atlas Antibodies

Catalog No.:
ATL-HPA055936-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 100
Gene Name: TMEM100
Alternative Gene Name: FLJ10970, FLJ37856
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069763: 72%, ENSRNOG00000002434: 77%
Entrez Gene ID: 55273
Uniprot ID: Q9NV29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG
Gene Sequence MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG
Gene ID - Mouse ENSMUSG00000069763
Gene ID - Rat ENSRNOG00000002434
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMEM100 pAb (ATL-HPA055936)
Datasheet Anti TMEM100 pAb (ATL-HPA055936) Datasheet (External Link)
Vendor Page Anti TMEM100 pAb (ATL-HPA055936) at Atlas Antibodies

Documents & Links for Anti TMEM100 pAb (ATL-HPA055936)
Datasheet Anti TMEM100 pAb (ATL-HPA055936) Datasheet (External Link)
Vendor Page Anti TMEM100 pAb (ATL-HPA055936)