Anti TMEM100 pAb (ATL-HPA055936)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055936-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TMEM100
Alternative Gene Name: FLJ10970, FLJ37856
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069763: 72%, ENSRNOG00000002434: 77%
Entrez Gene ID: 55273
Uniprot ID: Q9NV29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG |
| Gene Sequence | MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG |
| Gene ID - Mouse | ENSMUSG00000069763 |
| Gene ID - Rat | ENSRNOG00000002434 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM100 pAb (ATL-HPA055936) | |
| Datasheet | Anti TMEM100 pAb (ATL-HPA055936) Datasheet (External Link) |
| Vendor Page | Anti TMEM100 pAb (ATL-HPA055936) at Atlas Antibodies |
| Documents & Links for Anti TMEM100 pAb (ATL-HPA055936) | |
| Datasheet | Anti TMEM100 pAb (ATL-HPA055936) Datasheet (External Link) |
| Vendor Page | Anti TMEM100 pAb (ATL-HPA055936) |