Anti TMED9 pAb (ATL-HPA014650)

Atlas Antibodies

Catalog No.: ATL-HPA014650-25

Protein Description: transmembrane p24 trafficking protein 9
Gene Name: TMED9
Alternative Gene Name: HSGP25L2G, p24a2, p24alpha2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058569: 100%, ENSRNOG00000021882: 100%
Entrez Gene ID: 54732
Uniprot ID: Q9BVK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHS
• Gene Sequence: GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHS
• Gene ID - Mouse: ENSMUSG00000058569
• Gene ID - Rat: ENSRNOG00000021882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMED9 pAb (ATL-HPA014650) – 1 Found

Han, Gwan Hee; Yun, Hee; Chung, Joon-Yong; Kim, Jae-Hoon; Cho, Hanbyoul. TMED9 Expression Level as a Biomarker of Epithelial Ovarian Cancer Progression and Prognosis. Cancer Genomics & Proteomics. 2022;19(6):692-702.