Anti TMCO4 pAb (ATL-HPA014620)

Atlas Antibodies

Catalog No.:
ATL-HPA014620-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transmembrane and coiled-coil domains 4
Gene Name: TMCO4
Alternative Gene Name: DKFZp686C23231
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041143: 78%, ENSRNOG00000017401: 80%
Entrez Gene ID: 255104
Uniprot ID: Q5TGY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE
Gene Sequence QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE
Gene ID - Mouse ENSMUSG00000041143
Gene ID - Rat ENSRNOG00000017401
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMCO4 pAb (ATL-HPA014620)
Datasheet Anti TMCO4 pAb (ATL-HPA014620) Datasheet (External Link)
Vendor Page Anti TMCO4 pAb (ATL-HPA014620) at Atlas Antibodies

Documents & Links for Anti TMCO4 pAb (ATL-HPA014620)
Datasheet Anti TMCO4 pAb (ATL-HPA014620) Datasheet (External Link)
Vendor Page Anti TMCO4 pAb (ATL-HPA014620)