Anti TMCO4 pAb (ATL-HPA014620)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014620-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMCO4
Alternative Gene Name: DKFZp686C23231
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041143: 78%, ENSRNOG00000017401: 80%
Entrez Gene ID: 255104
Uniprot ID: Q5TGY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE |
| Gene Sequence | QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE |
| Gene ID - Mouse | ENSMUSG00000041143 |
| Gene ID - Rat | ENSRNOG00000017401 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMCO4 pAb (ATL-HPA014620) | |
| Datasheet | Anti TMCO4 pAb (ATL-HPA014620) Datasheet (External Link) |
| Vendor Page | Anti TMCO4 pAb (ATL-HPA014620) at Atlas Antibodies |
| Documents & Links for Anti TMCO4 pAb (ATL-HPA014620) | |
| Datasheet | Anti TMCO4 pAb (ATL-HPA014620) Datasheet (External Link) |
| Vendor Page | Anti TMCO4 pAb (ATL-HPA014620) |