Anti TMCO4 pAb (ATL-HPA014601)

Atlas Antibodies

Catalog No.: ATL-HPA014601-25

Protein Description: transmembrane and coiled-coil domains 4
Gene Name: TMCO4
Alternative Gene Name: DKFZp686C23231
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041143: 78%, ENSRNOG00000017401: 80%
Entrez Gene ID: 255104
Uniprot ID: Q5TGY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE
• Gene Sequence: QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE
• Gene ID - Mouse: ENSMUSG00000041143
• Gene ID - Rat: ENSRNOG00000017401
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.