Anti TMC2 pAb (ATL-HPA046350)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046350-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMC2
Alternative Gene Name: C20orf145, dJ686C3.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060332: 64%, ENSRNOG00000007017: 61%
Entrez Gene ID: 117532
Uniprot ID: Q8TDI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT |
Gene Sequence | QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT |
Gene ID - Mouse | ENSMUSG00000060332 |
Gene ID - Rat | ENSRNOG00000007017 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMC2 pAb (ATL-HPA046350) | |
Datasheet | Anti TMC2 pAb (ATL-HPA046350) Datasheet (External Link) |
Vendor Page | Anti TMC2 pAb (ATL-HPA046350) at Atlas Antibodies |
Documents & Links for Anti TMC2 pAb (ATL-HPA046350) | |
Datasheet | Anti TMC2 pAb (ATL-HPA046350) Datasheet (External Link) |
Vendor Page | Anti TMC2 pAb (ATL-HPA046350) |