Anti TMC2 pAb (ATL-HPA046350)

Atlas Antibodies

Catalog No.:
ATL-HPA046350-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transmembrane channel-like 2
Gene Name: TMC2
Alternative Gene Name: C20orf145, dJ686C3.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060332: 64%, ENSRNOG00000007017: 61%
Entrez Gene ID: 117532
Uniprot ID: Q8TDI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT
Gene Sequence QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT
Gene ID - Mouse ENSMUSG00000060332
Gene ID - Rat ENSRNOG00000007017
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMC2 pAb (ATL-HPA046350)
Datasheet Anti TMC2 pAb (ATL-HPA046350) Datasheet (External Link)
Vendor Page Anti TMC2 pAb (ATL-HPA046350) at Atlas Antibodies

Documents & Links for Anti TMC2 pAb (ATL-HPA046350)
Datasheet Anti TMC2 pAb (ATL-HPA046350) Datasheet (External Link)
Vendor Page Anti TMC2 pAb (ATL-HPA046350)