Anti TMA7 pAb (ATL-HPA047397)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047397-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TMA7
Alternative Gene Name: CCDC72, HSPC016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091537: 95%, ENSRNOG00000047225: 95%
Entrez Gene ID: 51372
Uniprot ID: Q9Y2S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE |
| Gene Sequence | GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE |
| Gene ID - Mouse | ENSMUSG00000091537 |
| Gene ID - Rat | ENSRNOG00000047225 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMA7 pAb (ATL-HPA047397) | |
| Datasheet | Anti TMA7 pAb (ATL-HPA047397) Datasheet (External Link) |
| Vendor Page | Anti TMA7 pAb (ATL-HPA047397) at Atlas Antibodies |
| Documents & Links for Anti TMA7 pAb (ATL-HPA047397) | |
| Datasheet | Anti TMA7 pAb (ATL-HPA047397) Datasheet (External Link) |
| Vendor Page | Anti TMA7 pAb (ATL-HPA047397) |