Anti TMA7 pAb (ATL-HPA047397)

Atlas Antibodies

Catalog No.:
ATL-HPA047397-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: translation machinery associated 7 homolog
Gene Name: TMA7
Alternative Gene Name: CCDC72, HSPC016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091537: 95%, ENSRNOG00000047225: 95%
Entrez Gene ID: 51372
Uniprot ID: Q9Y2S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE
Gene Sequence GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE
Gene ID - Mouse ENSMUSG00000091537
Gene ID - Rat ENSRNOG00000047225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMA7 pAb (ATL-HPA047397)
Datasheet Anti TMA7 pAb (ATL-HPA047397) Datasheet (External Link)
Vendor Page Anti TMA7 pAb (ATL-HPA047397) at Atlas Antibodies

Documents & Links for Anti TMA7 pAb (ATL-HPA047397)
Datasheet Anti TMA7 pAb (ATL-HPA047397) Datasheet (External Link)
Vendor Page Anti TMA7 pAb (ATL-HPA047397)