Anti TISP43 pAb (ATL-HPA044732)

Atlas Antibodies

Catalog No.:
ATL-HPA044732-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: uncharacterized LOC150527
Gene Name: TISP43
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053749: 38%, ENSRNOG00000032639: 40%
Entrez Gene ID: 150527
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGKAICRVSGLTLSPLCCPGPLPQGLLWTLPQPRLLPEPSQA
Gene Sequence TGKAICRVSGLTLSPLCCPGPLPQGLLWTLPQPRLLPEPSQA
Gene ID - Mouse ENSMUSG00000053749
Gene ID - Rat ENSRNOG00000032639
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TISP43 pAb (ATL-HPA044732)
Datasheet Anti TISP43 pAb (ATL-HPA044732) Datasheet (External Link)
Vendor Page Anti TISP43 pAb (ATL-HPA044732) at Atlas Antibodies

Documents & Links for Anti TISP43 pAb (ATL-HPA044732)
Datasheet Anti TISP43 pAb (ATL-HPA044732) Datasheet (External Link)
Vendor Page Anti TISP43 pAb (ATL-HPA044732)