Anti TIMM17B pAb (ATL-HPA029093)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029093-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TIMM17B
Alternative Gene Name: DXS9822, JM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031158: 92%, ENSRNOG00000048613: 90%
Entrez Gene ID: 10245
Uniprot ID: O60830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH |
| Gene Sequence | ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH |
| Gene ID - Mouse | ENSMUSG00000031158 |
| Gene ID - Rat | ENSRNOG00000048613 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TIMM17B pAb (ATL-HPA029093) | |
| Datasheet | Anti TIMM17B pAb (ATL-HPA029093) Datasheet (External Link) |
| Vendor Page | Anti TIMM17B pAb (ATL-HPA029093) at Atlas Antibodies |
| Documents & Links for Anti TIMM17B pAb (ATL-HPA029093) | |
| Datasheet | Anti TIMM17B pAb (ATL-HPA029093) Datasheet (External Link) |
| Vendor Page | Anti TIMM17B pAb (ATL-HPA029093) |