Anti TIMM17B pAb (ATL-HPA029093)

Atlas Antibodies

Catalog No.: ATL-HPA029093-25

Protein Description: translocase of inner mitochondrial membrane 17 homolog B (yeast)
Gene Name: TIMM17B
Alternative Gene Name: DXS9822, JM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031158: 92%, ENSRNOG00000048613: 90%
Entrez Gene ID: 10245
Uniprot ID: O60830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
• Gene Sequence: ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
• Gene ID - Mouse: ENSMUSG00000031158
• Gene ID - Rat: ENSRNOG00000048613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.