Anti TIMM13 pAb (ATL-HPA048985)

Atlas Antibodies

Catalog No.:
ATL-HPA048985-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane 13 homolog (yeast)
Gene Name: TIMM13
Alternative Gene Name: Tim13, TIMM13B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020219: 93%, ENSRNOG00000019682: 93%
Entrez Gene ID: 26517
Uniprot ID: Q9Y5L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD
Gene Sequence MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD
Gene ID - Mouse ENSMUSG00000020219
Gene ID - Rat ENSRNOG00000019682
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIMM13 pAb (ATL-HPA048985)
Datasheet Anti TIMM13 pAb (ATL-HPA048985) Datasheet (External Link)
Vendor Page Anti TIMM13 pAb (ATL-HPA048985) at Atlas Antibodies

Documents & Links for Anti TIMM13 pAb (ATL-HPA048985)
Datasheet Anti TIMM13 pAb (ATL-HPA048985) Datasheet (External Link)
Vendor Page Anti TIMM13 pAb (ATL-HPA048985)