Anti TIMM13 pAb (ATL-HPA048985)

Atlas Antibodies

SKU: ATL-HPA048985-25

• 
• 

Protein Description: translocase of inner mitochondrial membrane 13 homolog (yeast)
Gene Name: TIMM13
Alternative Gene Name: Tim13, TIMM13B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020219: 93%, ENSRNOG00000019682: 93%
Entrez Gene ID: 26517
Uniprot ID: Q9Y5L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD
• Gene Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD
• Gene ID - Mouse: ENSMUSG00000020219
• Gene ID - Rat: ENSRNOG00000019682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.