Anti TIGD6 pAb (ATL-HPA044599)

Atlas Antibodies

Catalog No.:
ATL-HPA044599-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tigger transposable element derived 6
Gene Name: TIGD6
Alternative Gene Name: DKFZp761E2110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047819: 36%, ENSRNOG00000010741: 36%
Entrez Gene ID: 81789
Uniprot ID: Q17RP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLGYDNFQASVGWLNRFRDRHGIALKAVCREDSDRLMNGLGIDKINEWHAGEIIKLIADYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRL
Gene Sequence MLGYDNFQASVGWLNRFRDRHGIALKAVCREDSDRLMNGLGIDKINEWHAGEIIKLIADYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRL
Gene ID - Mouse ENSMUSG00000047819
Gene ID - Rat ENSRNOG00000010741
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIGD6 pAb (ATL-HPA044599)
Datasheet Anti TIGD6 pAb (ATL-HPA044599) Datasheet (External Link)
Vendor Page Anti TIGD6 pAb (ATL-HPA044599) at Atlas Antibodies

Documents & Links for Anti TIGD6 pAb (ATL-HPA044599)
Datasheet Anti TIGD6 pAb (ATL-HPA044599) Datasheet (External Link)
Vendor Page Anti TIGD6 pAb (ATL-HPA044599)