Anti THSD7B pAb (ATL-HPA051416)
Atlas Antibodies
- SKU:
- ATL-HPA051416-25
- Shipping:
- Calculated at Checkout
$303.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Gene Name: THSD7B
Alternative Gene Name: KIAA1679
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042581: 87%, ENSRNOG00000003878: 90%
Entrez Gene ID: 80731
Uniprot ID: Q9C0I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEW |
Gene Sequence | VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEW |
Gene ID - Mouse | ENSMUSG00000042581 |
Gene ID - Rat | ENSRNOG00000003878 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti THSD7B pAb (ATL-HPA051416) | |
Datasheet | Anti THSD7B pAb (ATL-HPA051416) Datasheet (External Link) |
Vendor Page | Anti THSD7B pAb (ATL-HPA051416) at Atlas Antibodies |
Documents & Links for Anti THSD7B pAb (ATL-HPA051416) | |
Datasheet | Anti THSD7B pAb (ATL-HPA051416) Datasheet (External Link) |
Vendor Page | Anti THSD7B pAb (ATL-HPA051416) |